Fibromodulin antibody (70R-5310)

Rabbit polyclonal Fibromodulin antibody raised against the N terminal of FMOD

Synonyms Polyclonal Fibromodulin antibody, Anti-Fibromodulin antibody, SLRR2E antibody, FMOD antibody
Specificity Fibromodulin antibody was raised against the N terminal of FMOD
Cross Reactivity Human,Mouse
Applications WB
Immunogen Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
Assay Information Fibromodulin Blocking Peptide, catalog no. 33R-9917, is also available for use as a blocking control in assays to test for specificity of this Fibromodulin antibody


Western Blot analysis using Fibromodulin antibody (70R-5310)

Fibromodulin antibody (70R-5310) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FMOD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Fibromodulin antibody (70R-5310) | Fibromodulin antibody (70R-5310) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors