FKBP2 antibody (70R-5298)

Rabbit polyclonal FKBP2 antibody raised against the N terminal of FKBP2

Synonyms Polyclonal FKBP2 antibody, Anti-FKBP2 antibody, FK 506, FKBP-13 antibody, FK506, FK-506, PPIase antibody, FK 506 antibody, Fk506 Binding Protein 2 13Kda antibody, FK-506 antibody
Specificity FKBP2 antibody was raised against the N terminal of FKBP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV
Assay Information FKBP2 Blocking Peptide, catalog no. 33R-8052, is also available for use as a blocking control in assays to test for specificity of this FKBP2 antibody


Western Blot analysis using FKBP2 antibody (70R-5298)

FKBP2 antibody (70R-5298) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FKBP2 antibody (70R-5298) | FKBP2 antibody (70R-5298) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors