FKBPL antibody (70R-3368)

Rabbit polyclonal FKBPL antibody raised against the N terminal of FKBPL

Synonyms Polyclonal FKBPL antibody, Anti-FKBPL antibody, FK 506, FK 506 antibody, FK506, WISP39 antibody, DIR1 antibody, FK-506, FK-506 antibody, Fk506 Binding Protein Like antibody, NG7 antibody
Specificity FKBPL antibody was raised against the N terminal of FKBPL
Cross Reactivity Human
Applications WB
Immunogen FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE
Assay Information FKBPL Blocking Peptide, catalog no. 33R-5971, is also available for use as a blocking control in assays to test for specificity of this FKBPL antibody


Western Blot analysis using FKBPL antibody (70R-3368)

FKBPL antibody (70R-3368) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBPL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FKBPL antibody (70R-3368) | FKBPL antibody (70R-3368) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors