FKTN antibody (70R-1753)

Rabbit polyclonal FKTN antibody raised against the N terminal Of Fktn

Synonyms Polyclonal FKTN antibody, Anti-FKTN antibody, FKTN antibody, fukutin antibody
Specificity FKTN antibody was raised against the N terminal Of Fktn
Cross Reactivity Human,Rat,Dog
Applications IHC, WB
Immunogen FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL
Assay Information FKTN Blocking Peptide, catalog no. 33R-8971, is also available for use as a blocking control in assays to test for specificity of this FKTN antibody


Immunohistochemical staining using FKTN antibody (70R-1753)

FKTN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FKTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKTN regulates the migration and assembly of neurons during cortical histogenesis. Fukuyama congenital muscular dystrophy results from mutations in its gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FKTN antibody (70R-1753) | FKTN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using FKTN antibody (70R-1753) | FKTN antibody (70R-1753) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors