FLJ22167 antibody (70R-1787)

Rabbit polyclonal FLJ22167 antibody raised against the N terminal of FLJ22167

Synonyms Polyclonal FLJ22167 antibody, Anti-FLJ22167 antibody, FLJ22167, FLJ 22167 antibody, FLJ-22167, FLJ-22167 antibody, ALYE870 antibody, PRO1886 antibody, FLJ 22167, Hypothetical Protein Flj22167 antibody
Specificity FLJ22167 antibody was raised against the N terminal of FLJ22167
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA
Assay Information FLJ22167 Blocking Peptide, catalog no. 33R-1707, is also available for use as a blocking control in assays to test for specificity of this FLJ22167 antibody


Immunohistochemical staining using FLJ22167 antibody (70R-1787)

FLJ22167 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FLJ22167 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FLJ22167 antibody (70R-1787) | FLJ22167 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using FLJ22167 antibody (70R-1787) | FLJ22167 antibody (70R-1787) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors