FLJ37300 antibody (70R-5590)

Rabbit polyclonal FLJ37300 antibody raised against the N terminal Of Flj37300

Synonyms Polyclonal FLJ37300 antibody, Anti-FLJ37300 antibody, FLJ 37300, FLJ 37300 antibody, FLJ37300, FLJ-37300 antibody, FLJ-37300, Hypothetical Protein Flj37300 antibody
Specificity FLJ37300 antibody was raised against the N terminal Of Flj37300
Cross Reactivity Human
Applications WB
Immunogen FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE
Assay Information FLJ37300 Blocking Peptide, catalog no. 33R-2807, is also available for use as a blocking control in assays to test for specificity of this FLJ37300 antibody


Western Blot analysis using FLJ37300 antibody (70R-5590)

FLJ37300 antibody (70R-5590) used at 0.125 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ37300 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FLJ37300 is a hypothetical protein found on chromosome 17.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ37300 antibody (70R-5590) | FLJ37300 antibody (70R-5590) used at 0.125 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors