FLJ37543 antibody (70R-3286)

Rabbit polyclonal FLJ37543 antibody raised against the N terminal of FLJ37543

Synonyms Polyclonal FLJ37543 antibody, Anti-FLJ37543 antibody, MGC138213 antibody, FLJ 37543 antibody, FLJ37543, Hypothetical Protein Flj37543 antibody, FLJ-37543, MGC138187 antibody, FLJ-37543 antibody, FLJ 37543
Specificity FLJ37543 antibody was raised against the N terminal of FLJ37543
Cross Reactivity Human
Applications WB
Immunogen FLJ37543 antibody was raised using the N terminal of FLJ37543 corresponding to a region with amino acids MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP
Assay Information FLJ37543 Blocking Peptide, catalog no. 33R-6178, is also available for use as a blocking control in assays to test for specificity of this FLJ37543 antibody


Western Blot analysis using FLJ37543 antibody (70R-3286)

FLJ37543 antibody (70R-3286) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ37543 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ37543 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ37543 antibody (70R-3286) | FLJ37543 antibody (70R-3286) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors