FRS3 antibody (70R-2077)

Rabbit polyclonal FRS3 antibody raised against the middle region of FRS3

Synonyms Polyclonal FRS3 antibody, Anti-FRS3 antibody, FRS2B antibody, FRS3, FRS 3 antibody, FRS 3, FRS2beta antibody, Fibroblast Growth Factor Receptor Substrate 3 antibody, MGC17167 antibody, FRS-3, FRS-3 antibody, SNT-2 antibody, SNT2 antibody
Specificity FRS3 antibody was raised against the middle region of FRS3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FRS3 antibody was raised using the middle region of FRS3 corresponding to a region with amino acids GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG
Assay Information FRS3 Blocking Peptide, catalog no. 33R-3263, is also available for use as a blocking control in assays to test for specificity of this FRS3 antibody


Western Blot analysis using FRS3 antibody (70R-2077)

FRS3 antibody (70R-2077) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FRS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FRS3 antibody (70R-2077) | FRS3 antibody (70R-2077) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors