FSTL5 antibody (70R-1991)

Rabbit polyclonal FSTL5 antibody raised against the middle region of FSTL5

Synonyms Polyclonal FSTL5 antibody, Anti-FSTL5 antibody, DKFZp566D234 antibody, KIAA1263 antibody, Follistatin-Like 5 antibody
Specificity FSTL5 antibody was raised against the middle region of FSTL5
Cross Reactivity Human
Applications WB
Immunogen FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD
Assay Information FSTL5 Blocking Peptide, catalog no. 33R-6862, is also available for use as a blocking control in assays to test for specificity of this FSTL5 antibody


Western Blot analysis using FSTL5 antibody (70R-1991)

FSTL5 antibody (70R-1991) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FSTL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Follistatin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FSTL5 antibody (70R-1991) | FSTL5 antibody (70R-1991) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors