FTCD antibody (70R-1140)

Rabbit polyclonal FTCD antibody raised against the N terminal of FTCD

Synonyms Polyclonal FTCD antibody, Anti-FTCD antibody, Formiminotransferase Cyclodeaminase antibody, LCHC1 antibody
Specificity FTCD antibody was raised against the N terminal of FTCD
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
Assay Information FTCD Blocking Peptide, catalog no. 33R-3055, is also available for use as a blocking control in assays to test for specificity of this FTCD antibody


Immunohistochemical staining using FTCD antibody (70R-1140)

FTCD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FTCD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FTCD antibody (70R-1140) | FTCD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using FTCD antibody (70R-1140) | FTCD antibody (70R-1140) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using FTCD antibody (70R-1140) | FTCD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors