FTCD antibody (70R-2476)

Rabbit polyclonal FTCD antibody raised against the middle region of FTCD

Synonyms Polyclonal FTCD antibody, Anti-FTCD antibody, Formiminotransferase Cyclodeaminase antibody, LCHC1 antibody
Specificity FTCD antibody was raised against the middle region of FTCD
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
Assay Information FTCD Blocking Peptide, catalog no. 33R-4373, is also available for use as a blocking control in assays to test for specificity of this FTCD antibody


Immunohistochemical staining using FTCD antibody (70R-2476)

FTCD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FTCD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FTCD antibody (70R-2476) | FTCD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using FTCD antibody (70R-2476) | FTCD antibody (70R-2476) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors