FUNDC1 antibody (70R-3364)

Rabbit polyclonal FUNDC1 antibody raised against the middle region of FUNDC1

Synonyms Polyclonal FUNDC1 antibody, Anti-FUNDC1 antibody, Fun14 Domain Containing 1 antibody, MGC51029 antibody
Specificity FUNDC1 antibody was raised against the middle region of FUNDC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FUNDC1 antibody was raised using the middle region of FUNDC1 corresponding to a region with amino acids TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN
Assay Information FUNDC1 Blocking Peptide, catalog no. 33R-8988, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody


Western Blot analysis using FUNDC1 antibody (70R-3364)

FUNDC1 antibody (70R-3364) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUNDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FUNDC1 antibody (70R-3364) | FUNDC1 antibody (70R-3364) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors