FUSIP1 antibody (70R-4911)

Rabbit polyclonal FUSIP1 antibody

Synonyms Polyclonal FUSIP1 antibody, Anti-FUSIP1 antibody, Serine/Arginine-Rich 1 antibody, NSSR antibody, FUSIP2 antibody, SRp38 antibody, TASR1 antibody, SFRS13 antibody, TASR antibody, Fus Interacting Protein antibody, SRrp40 antibody, TASR2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FUSIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP
Assay Information FUSIP1 Blocking Peptide, catalog no. 33R-6494, is also available for use as a blocking control in assays to test for specificity of this FUSIP1 antibody


Western Blot analysis using FUSIP1 antibody (70R-4911)

FUSIP1 antibody (70R-4911) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUSIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FUSIP1 antibody (70R-4911) | FUSIP1 antibody (70R-4911) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors