FUT6 antibody (70R-5379)

Rabbit polyclonal FUT6 antibody raised against the C terminal of FUT6

Synonyms Polyclonal FUT6 antibody, Anti-FUT6 antibody, FLJ40754 antibody, FT1A antibody, Fucosyltransferase 6 antibody
Specificity FUT6 antibody was raised against the C terminal of FUT6
Cross Reactivity Human
Applications WB
Immunogen FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR
Assay Information FUT6 Blocking Peptide, catalog no. 33R-10142, is also available for use as a blocking control in assays to test for specificity of this FUT6 antibody


Western Blot analysis using FUT6 antibody (70R-5379)

FUT6 antibody (70R-5379) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FUT6 antibody (70R-5379) | FUT6 antibody (70R-5379) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors