FXYD7 antibody (70R-5161)

Rabbit polyclonal FXYD7 antibody raised against the N terminal of FXYD7

Synonyms Polyclonal FXYD7 antibody, Anti-FXYD7 antibody, Fxyd Domain Containing Ion Transport Regulator 7 antibody, Fsxyd7, Fsxyd 7, FLJ25096 antibody, Fsxyd-7 antibody, Fsxyd-7, Fsxyd 7 antibody
Specificity FXYD7 antibody was raised against the N terminal of FXYD7
Cross Reactivity Human
Applications WB
Immunogen FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
Assay Information FXYD7 Blocking Peptide, catalog no. 33R-5788, is also available for use as a blocking control in assays to test for specificity of this FXYD7 antibody


Western Blot analysis using FXYD7 antibody (70R-5161)

FXYD7 antibody (70R-5161) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 8 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FXYD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FXYD7 antibody (70R-5161) | FXYD7 antibody (70R-5161) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors