GABARAP antibody (70R-2213)

Rabbit polyclonal GABARAP antibody

Synonyms Polyclonal GABARAP antibody, Anti-GABARAP antibody, MGC120155 antibody, MM46 antibody, FLJ25768 antibody, Gaba A receptor-associated protein antibody, MGC120154 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV
Assay Information GABARAP Blocking Peptide, catalog no. 33R-4382, is also available for use as a blocking control in assays to test for specificity of this GABARAP antibody

Images

Western Blot analysis using GABARAP antibody (70R-2213)

GABARAP antibody (70R-2213) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABARAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GABARAP antibody (70R-2213) | GABARAP antibody (70R-2213) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors