GABRA4 antibody (70R-5205)

Rabbit polyclonal GABRA4 antibody

Synonyms Polyclonal GABRA4 antibody, Anti-GABRA4 antibody, Gamma-Aminobutyric Acid antibody, Gaba A Receptor Alpha 4 antibody
Cross Reactivity Human
Applications WB
Immunogen GABRA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR
Assay Information GABRA4 Blocking Peptide, catalog no. 33R-6607, is also available for use as a blocking control in assays to test for specificity of this GABRA4 antibody


Western Blot analysis using GABRA4 antibody (70R-5205)

GABRA4 antibody (70R-5205) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRA4 antibody (70R-5205) | GABRA4 antibody (70R-5205) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors