GABRB1 antibody (70R-5187)

Rabbit polyclonal GABRB1 antibody

Synonyms Polyclonal GABRB1 antibody, Anti-GABRB1 antibody, Gaba A Receptor Beta 1 antibody, Gamma-Aminobutyric Acid antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GABRB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT
Assay Information GABRB1 Blocking Peptide, catalog no. 33R-9165, is also available for use as a blocking control in assays to test for specificity of this GABRB1 antibody

Images

Western Blot analysis using GABRB1 antibody (70R-5187)

GABRB1 antibody (70R-5187) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GABRB1 antibody (70R-5187) | GABRB1 antibody (70R-5187) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors