GABRR2 antibody (70R-5209)

Rabbit polyclonal GABRR2 antibody

Synonyms Polyclonal GABRR2 antibody, Anti-GABRR2 antibody, Gamma-Aminobutyric Acid antibody, Gaba Receptor Rho 2 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen GABRR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
Assay Information GABRR2 Blocking Peptide, catalog no. 33R-8654, is also available for use as a blocking control in assays to test for specificity of this GABRR2 antibody


Western Blot analysis using GABRR2 antibody (70R-5209)

GABRR2 antibody (70R-5209) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRR2 antibody (70R-5209) | GABRR2 antibody (70R-5209) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors