GALNT10 antibody (70R-5370)

Rabbit polyclonal GALNT10 antibody raised against the N terminal Of Galnt10

Synonyms Polyclonal GALNT10 antibody, Anti-GALNT10 antibody, FLJ11715 antibody, pp-GalNAc-T10 antibody, DKFZp586H0623 antibody, GalNAcT10 antibody, FLJ00205 antibody
Specificity GALNT10 antibody was raised against the N terminal Of Galnt10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS
Assay Information GALNT10 Blocking Peptide, catalog no. 33R-9717, is also available for use as a blocking control in assays to test for specificity of this GALNT10 antibody


Western Blot analysis using GALNT10 antibody (70R-5370)

GALNT10 antibody (70R-5370) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNT10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GALNT10 antibody (70R-5370) | GALNT10 antibody (70R-5370) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors