GALT antibody (70R-2643)

Rabbit polyclonal GALT antibody raised against the C terminal of GALT

Synonyms Polyclonal GALT antibody, Anti-GALT antibody, Galactose-1-Phosphate Uridylyltransferase antibody
Specificity GALT antibody was raised against the C terminal of GALT
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET
Assay Information GALT Blocking Peptide, catalog no. 33R-5189, is also available for use as a blocking control in assays to test for specificity of this GALT antibody


Western Blot analysis using GALT antibody (70R-2643)

GALT antibody (70R-2643) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GALT antibody (70R-2643) | GALT antibody (70R-2643) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors