GAMT antibody (70R-2584)

Rabbit polyclonal GAMT antibody raised against the N terminal of GAMT

Synonyms Polyclonal GAMT antibody, Anti-GAMT antibody, PIG2 antibody, TP53I2 antibody, Guanidinoacetate N-Methyltransferase antibody
Specificity GAMT antibody was raised against the N terminal of GAMT
Cross Reactivity Human
Applications WB
Immunogen GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM
Assay Information GAMT Blocking Peptide, catalog no. 33R-6399, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Images

Western Blot analysis using GAMT antibody (70R-2584)

GAMT antibody (70R-2584) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GAMT antibody (70R-2584) | GAMT antibody (70R-2584) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors