GAN antibody (70R-4075)

Rabbit polyclonal GAN antibody raised against the middle region of GAN

Synonyms Polyclonal GAN antibody, Anti-GAN antibody, KLHL16 antibody, GAN1 antibody, Gigaxonin antibody, FLJ38059 antibody
Specificity GAN antibody was raised against the middle region of GAN
Cross Reactivity Human
Applications WB
Immunogen GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Assay Information GAN Blocking Peptide, catalog no. 33R-4223, is also available for use as a blocking control in assays to test for specificity of this GAN antibody


Western Blot analysis using GAN antibody (70R-4075)

GAN antibody (70R-4075) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GAN antibody (70R-4075) | GAN antibody (70R-4075) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors