GARS antibody (70R-2361)

Rabbit polyclonal GARS antibody raised against the middle region of GARS

Synonyms Polyclonal GARS antibody, Anti-GARS antibody, SMAD1 antibody, HMN5 antibody, GlyRS antibody, Glycyl-tRNA Synthetase antibody, DSMAV antibody, CMT2D antibody
Specificity GARS antibody was raised against the middle region of GARS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN
Assay Information GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody


Western Blot analysis using GARS antibody (70R-2361)

GARS antibody (70R-2361) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GARS antibody (70R-2361) | GARS antibody (70R-2361) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors