GATM antibody (70R-2511)

Rabbit polyclonal GATM antibody

Synonyms Polyclonal GATM antibody, Anti-GATM antibody, Glycine Amidinotransferase antibody, L-Arginine:Glycine Amidinotransferase antibody, AGAT antibody, AT antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GATM antibody was raised using a synthetic peptide corresponding to a region with amino acids PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
Assay Information GATM Blocking Peptide, catalog no. 33R-6995, is also available for use as a blocking control in assays to test for specificity of this GATM antibody

Images

Western Blot analysis using GATM antibody (70R-2511)

GATM antibody (70R-2511) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GATM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GATM antibody (70R-2511) | GATM antibody (70R-2511) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £300.47
Size: 50 ug
OR
Shipping
View Our Distributors