GBP2 antibody (70R-4040)

Rabbit polyclonal GBP2 antibody raised against the N terminal of GBP2

Synonyms Polyclonal GBP2 antibody, Anti-GBP2 antibody, Guanylate Binding Protein 2 Interferon-Inducible antibody
Specificity GBP2 antibody was raised against the N terminal of GBP2
Cross Reactivity Human
Applications WB
Immunogen GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE
Assay Information GBP2 Blocking Peptide, catalog no. 33R-3881, is also available for use as a blocking control in assays to test for specificity of this GBP2 antibody

Images

Western Blot analysis using GBP2 antibody (70R-4040)

GBP2 antibody (70R-4040) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GBP2 antibody (70R-4040) | GBP2 antibody (70R-4040) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors