GBX1 antibody (70R-3885)

Rabbit polyclonal GBX1 antibody raised against the middle region of Gbx-1

Synonyms Polyclonal GBX1 antibody, Anti-GBX1 antibody, GBX-1 antibody, GBX 1 antibody, GBX1, Gastrulation Brain Homeobox 1 antibody, GBX 1, GBX-1, GBX-1 antibody
Specificity GBX1 antibody was raised against the middle region of Gbx-1
Cross Reactivity Human, Mouse, Rat, Drosophila
Applications WB
Immunogen GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP
Assay Information GBX1 Blocking Peptide, catalog no. 33R-1314, is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody


Western Blot analysis using GBX1 antibody (70R-3885)

GBX1 antibody (70R-3885) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GBX-1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GBX1 antibody (70R-3885) | GBX1 antibody (70R-3885) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors