GCDH antibody (70R-2402)

Rabbit polyclonal GCDH antibody raised against the N terminal of GCDH

Synonyms Polyclonal GCDH antibody, Anti-GCDH antibody, ACAD5 antibody, GCD antibody, Glutaryl-Coenzyme A Dehydrogenase antibody
Specificity GCDH antibody was raised against the N terminal of GCDH
Cross Reactivity Human,Mouse
Applications WB
Immunogen GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA
Assay Information GCDH Blocking Peptide, catalog no. 33R-8632, is also available for use as a blocking control in assays to test for specificity of this GCDH antibody


Western Blot analysis using GCDH antibody (70R-2402)

GCDH antibody (70R-2402) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45 kDa subunits.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GCDH antibody (70R-2402) | GCDH antibody (70R-2402) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors