GCOM1 antibody (70R-3275)

Rabbit polyclonal GCOM1 antibody raised against the middle region of Gcom1

Synonyms Polyclonal GCOM1 antibody, Anti-GCOM1 antibody, Gup1 antibody, FLJ30973 antibody, Gup2 antibody, GRINL1A antibody, Gcom2 antibody, MGC126694 antibody, MGC138353 antibody
Specificity GCOM1 antibody was raised against the middle region of Gcom1
Cross Reactivity Human
Applications WB
Immunogen GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
Assay Information GCOM1 Blocking Peptide, catalog no. 33R-9433, is also available for use as a blocking control in assays to test for specificity of this GCOM1 antibody


Western Blot analysis using GCOM1 antibody (70R-3275)

GCOM1 antibody (70R-3275) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCOM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GCOM1 antibody (70R-3275) | GCOM1 antibody (70R-3275) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors