GDAP2 antibody (70R-3977)

Rabbit polyclonal GDAP2 antibody raised against the N terminal of GDAP2

Synonyms Polyclonal GDAP2 antibody, Anti-GDAP2 antibody, dJ776P7.1 antibody, FLJ20142 antibody, Ganglioside Induced Differentiation Associated Protein 2 antibody
Specificity GDAP2 antibody was raised against the N terminal of GDAP2
Cross Reactivity Human
Applications WB
Immunogen GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA
Assay Information GDAP2 Blocking Peptide, catalog no. 33R-1801, is also available for use as a blocking control in assays to test for specificity of this GDAP2 antibody


Western Blot analysis using GDAP2 antibody (70R-3977)

GDAP2 antibody (70R-3977) used at 0.0625 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDAP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.0625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GDAP protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GDAP2 antibody (70R-3977) | GDAP2 antibody (70R-3977) used at 0.0625 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors