GEM antibody (70R-1647)

Rabbit polyclonal GEM antibody raised against the C terminal of GEM

Synonyms Polyclonal GEM antibody, Anti-GEM antibody, KIR antibody, Gtp Binding Protein Overexpressed In Skeletal Muscle antibody, MGC26294 antibody
Specificity GEM antibody was raised against the C terminal of GEM
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
Assay Information GEM Blocking Peptide, catalog no. 33R-3073, is also available for use as a blocking control in assays to test for specificity of this GEM antibody


Immunohistochemical staining using GEM antibody (70R-1647)

GEM antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GEM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GEM antibody (70R-1647) | GEM antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X.
  • Western Blot analysis using GEM antibody (70R-1647) | GEM antibody (70R-1647) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using GEM antibody (70R-1647) | GEM antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors