Gem antibody (70R-2035)

Rabbit polyclonal Gem antibody

Synonyms Polyclonal Gem antibody, Anti-Gem antibody, Nuclear Organelle Associated Protein 4 antibody, HHRF-1 antibody, GEMIN4 antibody, DKFZP434B131 antibody, DKFZP434D174 antibody, HCAP1 antibody, HC56 antibody, p97 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen Gem antibody was raised using a synthetic peptide corresponding to a region with amino acids QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR
Assay Information Gem Blocking Peptide, catalog no. 33R-7463, is also available for use as a blocking control in assays to test for specificity of this Gem antibody


Western Blot analysis using Gem antibody (70R-2035)

Gem antibody (70R-2035) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GEMIN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Gem antibody (70R-2035) | Gem antibody (70R-2035) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors