GGN antibody (70R-2174)

Rabbit polyclonal GGN antibody raised against the N terminal of GGN

Synonyms Polyclonal GGN antibody, Anti-GGN antibody, MGC33369 antibody, Gametogenetin antibody, FLJ35713 antibody
Specificity GGN antibody was raised against the N terminal of GGN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GGN antibody was raised using the N terminal of GGN corresponding to a region with amino acids GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT
Assay Information GGN Blocking Peptide, catalog no. 33R-3484, is also available for use as a blocking control in assays to test for specificity of this GGN antibody


Western Blot analysis using GGN antibody (70R-2174)

GGN antibody (70R-2174) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GGN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GGN may be involved in spermatogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GGN antibody (70R-2174) | GGN antibody (70R-2174) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors