GGPS1 antibody (70R-2118)

Rabbit polyclonal GGPS1 antibody raised against the C terminal of GGPS1

Synonyms Polyclonal GGPS1 antibody, Anti-GGPS1 antibody, Geranylgeranyl Diphosphate Synthase 1 antibody, GGPPS antibody, GGPS1, GGPS-1, GGPS-1 antibody, GGPS 1 antibody, GGPS 1, GGPPS1 antibody
Specificity GGPS1 antibody was raised against the C terminal of GGPS1
Cross Reactivity Human
Applications WB
Immunogen GGPS1 antibody was raised using the C terminal of GGPS1 corresponding to a region with amino acids LEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Assay Information GGPS1 Blocking Peptide, catalog no. 33R-4885, is also available for use as a blocking control in assays to test for specificity of this GGPS1 antibody


Western Blot analysis using GGPS1 antibody (70R-2118)

GGPS1 antibody (70R-2118) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GGPS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GGPS1 is a member of the prenyltransferase family with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GGPS1 antibody (70R-2118) | GGPS1 antibody (70R-2118) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors