GINS1 antibody (70R-1239)

Rabbit polyclonal GINS1 antibody

Synonyms Polyclonal GINS1 antibody, Anti-GINS1 antibody, GINS 1 antibody, Gins Complex Subunit 1 antibody, GINS-1 antibody, GINS 1, GINS-1, GINS1, Psf1 Homolog antibody, PSF1 antibody, KIAA0186 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA
Assay Information GINS1 Blocking Peptide, catalog no. 33R-5986, is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Images

Western Blot analysis using GINS1 antibody (70R-1239)

GINS1 antibody (70R-1239) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GINS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The GINS complex plays an essential role in the initiation of DNA replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GINS1 antibody (70R-1239) | GINS1 antibody (70R-1239) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors