GK2 antibody (70R-3652)

Rabbit polyclonal GK2 antibody raised against the C terminal of GK2

Synonyms Polyclonal GK2 antibody, Anti-GK2 antibody, GK2, GKTA antibody, GK 2, GK-2 antibody, GK 2 antibody, Glycerol Kinase 2 antibody, GKP2 antibody, GK-2
Specificity GK2 antibody was raised against the C terminal of GK2
Cross Reactivity Human
Applications WB
Immunogen GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS
Assay Information GK2 Blocking Peptide, catalog no. 33R-7592, is also available for use as a blocking control in assays to test for specificity of this GK2 antibody


Western Blot analysis using GK2 antibody (70R-3652)

GK2 antibody (70R-3652) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GK2 antibody (70R-3652) | GK2 antibody (70R-3652) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors