GLCCI1 antibody (70R-4571)

Rabbit polyclonal GLCCI1 antibody raised against the middle region of GLCCI1

Synonyms Polyclonal GLCCI1 antibody, Anti-GLCCI1 antibody, GIG18 antibody, Glucocorticoid Induced Transcript 1 antibody, FAM117C antibody
Specificity GLCCI1 antibody was raised against the middle region of GLCCI1
Cross Reactivity Human
Applications WB
Immunogen GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD
Assay Information GLCCI1 Blocking Peptide, catalog no. 33R-7448, is also available for use as a blocking control in assays to test for specificity of this GLCCI1 antibody

Images

Western Blot analysis using GLCCI1 antibody (70R-4571)

GLCCI1 antibody (70R-4571) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLCCI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GLCCI protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLCCI1 antibody (70R-4571) | GLCCI1 antibody (70R-4571) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors