GLOD4 antibody (70R-3898)

Rabbit polyclonal GLOD4 antibody raised against the middle region of GLOD4

Synonyms Polyclonal GLOD4 antibody, Anti-GLOD4 antibody, Glyoxalase Domain Containing 4 antibody, GLOD 4 antibody, GLOD-4 antibody, GLOD-4, GLOD4, GLOD 4, CGI-150 antibody, HC71 antibody, C17orf25 antibody
Specificity GLOD4 antibody was raised against the middle region of GLOD4
Cross Reactivity Human,Mouse
Applications WB
Immunogen GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG
Assay Information GLOD4 Blocking Peptide, catalog no. 33R-4809, is also available for use as a blocking control in assays to test for specificity of this GLOD4 antibody


Western Blot analysis using GLOD4 antibody (70R-3898)

GLOD4 antibody (70R-3898) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLOD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GLOD4 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GLOD4 antibody (70R-3898) | GLOD4 antibody (70R-3898) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors