GNAS antibody (70R-1643)

Rabbit polyclonal GNAS antibody raised against the N terminal of GNAS

Synonyms Polyclonal GNAS antibody, Anti-GNAS antibody, C20orf45 antibody, GPSA antibody, Gnas Complex Locus antibody, GNAS1 antibody, GSA antibody, dJ806M20.3.3 antibody, MGC33735 antibody, PHP1B antibody, dJ309F20.1.1 antibody, POH antibody, GSP antibody, AHO antibody, PHP1A antibody
Specificity GNAS antibody was raised against the N terminal of GNAS
Cross Reactivity Human,Dog
Applications WB
Immunogen GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ
Assay Information GNAS Blocking Peptide, catalog no. 33R-6814, is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Images

Western Blot analysis using GNAS antibody (70R-1643)

GNAS antibody (70R-1643) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GNAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNAS antibody (70R-1643) | GNAS antibody (70R-1643) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors