GNAS antibody (70R-1652)

Rabbit polyclonal GNAS antibody raised against the N terminal of GNAS

Synonyms Polyclonal GNAS antibody, Anti-GNAS antibody, Gnas Complex Locus antibody, GPSA antibody, AHO antibody, dJ309F20.1.1 antibody, dJ806M20.3.3 antibody, GSA antibody, MGC33735 antibody, PHP1B antibody, GNAS1 antibody, PHP1A antibody, RP4-543J19.4 antibody, C20orf45 antibody, GSP antibody, POH antibody
Specificity GNAS antibody was raised against the N terminal of GNAS
Cross Reactivity Human
Applications IHC, WB
Immunogen GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
Assay Information GNAS Blocking Peptide, catalog no. 33R-8471, is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Images

Western Blot analysis using GNAS antibody (70R-1652)

GNAS antibody (70R-1652) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GNAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNAS antibody (70R-1652) | GNAS antibody (70R-1652) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using GNAS antibody (70R-1652) | GNAS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors