GNAZ antibody (70R-3649)

Rabbit polyclonal GNAZ antibody

Synonyms Polyclonal GNAZ antibody, Anti-GNAZ antibody, G Protein Alpha Z Polypeptide antibody, RNA guanine Nucleotide Binding Protein antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GNAZ antibody was raised using a synthetic peptide corresponding to a region with amino acids LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT
Assay Information GNAZ Blocking Peptide, catalog no. 33R-5047, is also available for use as a blocking control in assays to test for specificity of this GNAZ antibody

Images

Western Blot analysis using GNAZ antibody (70R-3649)

GNAZ antibody (70R-3649) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GNAZ antibody (70R-3649) | GNAZ antibody (70R-3649) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors