GPR87 antibody (70R-3913)

Rabbit polyclonal GPR87 antibody raised against the N terminal of GPR87

Synonyms Polyclonal GPR87 antibody, Anti-GPR87 antibody, GPR-87 antibody, GPR87, GPR95 antibody, G Protein-Coupled Receptor 87 antibody, KPG_002 antibody, GPR-87, FKSG78 antibody, GPR 87, GPR 87 antibody, MGC131898 antibody
Specificity GPR87 antibody was raised against the N terminal of GPR87
Cross Reactivity Human
Applications WB
Immunogen GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL
Assay Information GPR87 Blocking Peptide, catalog no. 33R-6027, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody


Western Blot analysis using GPR87 antibody (70R-3913)

GPR87 antibody (70R-3913) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPR87 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GPR87 antibody (70R-3913) | GPR87 antibody (70R-3913) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors