GPX3 antibody (70R-5305)

Rabbit polyclonal GPX3 antibody

Synonyms Polyclonal GPX3 antibody, Anti-GPX3 antibody, GPx-P antibody, Glutathione Peroxidase 3 antibody, GSHPx-P antibody, GSHPx-3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Assay Information GPX3 Blocking Peptide, catalog no. 33R-1870, is also available for use as a blocking control in assays to test for specificity of this GPX3 antibody


Western blot analysis using GPX3 antibody (70R-5305)

Recommended GPX3 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPX3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using GPX3 antibody (70R-5305) | Recommended GPX3 Antibody Titration: 0.2-1 ug/ml
  • Immunofluorescent staining using GPX3 antibody (70R-5305) | Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells  Primary Antibody Concentration: 1:100  Other Working Concentrations: 1/600  Secondary Antibody: Donkey anti-Rabbit-Cy3  Secondary Antibody Concentration: 1:200  Magnification: 20X  Exposure Time: 0.5 - 2.0

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors