GREM2 antibody (70R-3740)

Rabbit polyclonal GREM2 antibody

Synonyms Polyclonal GREM2 antibody, Anti-GREM2 antibody, Gremlin 2 Cysteine Knot Superfamily Homolog antibody, DAND3 antibody, PRDC antibody, CKTSF1B2 antibody
Cross Reactivity Human
Applications WB
Immunogen GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK
Assay Information GREM2 Blocking Peptide, catalog no. 33R-6009, is also available for use as a blocking control in assays to test for specificity of this GREM2 antibody


Western Blot analysis using GREM2 antibody (70R-3740)

GREM2 antibody (70R-3740) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GREM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GREM2 antibody (70R-3740) | GREM2 antibody (70R-3740) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors