GRIK2 antibody (70R-1522)

Rabbit polyclonal GRIK2 antibody raised against the N terminal of GRIK2

Synonyms Polyclonal GRIK2 antibody, Anti-GRIK2 antibody, GRIK-2, GRIK2, Glutamate Receptor Ionotropic Kainate 2 antibody, GRIK 2, GRIK 2 antibody, GRIK-2 antibody
Specificity GRIK2 antibody was raised against the N terminal of GRIK2
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLK
Assay Information GRIK2 Blocking Peptide, catalog no. 33R-7009, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody


Immunohistochemical staining using GRIK2 antibody (70R-1522)

GRIK2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GRIK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GRIK2 antibody (70R-1522) | GRIK2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using GRIK2 antibody (70R-1522) | GRIK2 antibody (70R-1522) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors