GRIK2 antibody (70R-5200)

Rabbit polyclonal GRIK2 antibody raised against the C terminal of GRIK2

Synonyms Polyclonal GRIK2 antibody, Anti-GRIK2 antibody, GRIK2, GRIK-2 antibody, Glutamate Receptor Ionotropic Kainate 2 antibody, GRIK 2, GRIK-2, GRIK 2 antibody
Specificity GRIK2 antibody was raised against the C terminal of GRIK2
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST
Assay Information GRIK2 Blocking Peptide, catalog no. 33R-8980, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody


Western Blot analysis using GRIK2 antibody (70R-5200)

GRIK2 antibody (70R-5200) used at 0.125 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GRIK2 antibody (70R-5200) | GRIK2 antibody (70R-5200) used at 0.125 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors