GRIK5 antibody (70R-5212)

Rabbit polyclonal GRIK5 antibody raised against the middle region of GRIK5

Synonyms Polyclonal GRIK5 antibody, Anti-GRIK5 antibody, GRIK 5, GRIK2 antibody, GRIK5, EAA2 antibody, KA2 antibody, GRIK-5 antibody, Glutamate Receptor Ionotropic Kainate 5 antibody, GRIK 5 antibody, GRIK-5
Specificity GRIK5 antibody was raised against the middle region of GRIK5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
Assay Information GRIK5 Blocking Peptide, catalog no. 33R-2313, is also available for use as a blocking control in assays to test for specificity of this GRIK5 antibody

Images

Western Blot analysis using GRIK5 antibody (70R-5212)

GRIK5 antibody (70R-5212) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GRIK5 antibody (70R-5212) | GRIK5 antibody (70R-5212) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors