GRIN2A antibody (70R-5207)

Rabbit polyclonal GRIN2A antibody raised against the middle region of GRIN2A

Synonyms Polyclonal GRIN2A antibody, Anti-GRIN2A antibody, GRINA-2 antibody, GRINA 2 antibody, Glutamate Receptor Ionotropic N-Methyl D-Aspartate 2A antibody, NR2A antibody, GRIN2A, GRINA 2, NMDAR2A antibody, GRINA-2
Specificity GRIN2A antibody was raised against the middle region of GRIN2A
Cross Reactivity Human
Applications WB
Immunogen GRIN2A antibody was raised using the middle region of GRIN2A corresponding to a region with amino acids DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Assay Information GRIN2A Blocking Peptide, catalog no. 33R-2020, is also available for use as a blocking control in assays to test for specificity of this GRIN2A antibody

Images

Western Blot analysis using GRIN2A antibody (70R-5207)

GRIN2A antibody (70R-5207) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 163 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIN2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate-gated ion channels. These receptors have been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C) and NMDAR2D (GRIN2D).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GRIN2A antibody (70R-5207) | GRIN2A antibody (70R-5207) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors