GRIN2B antibody (70R-5195)

Rabbit polyclonal GRIN2B antibody raised against the middle region of GRIN2B

Synonyms Polyclonal GRIN2B antibody, Anti-GRIN2B antibody, hNR3 antibody, Glutamate Receptor Ionotropic N-Methyl D-Aspartate 2B antibody, GRIN2B, GRINB 2 antibody, MGC142178 antibody, MGC142180 antibody, GRINB-2 antibody, GRINB 2, NMDAR2B antibody, NR2B antibody, GRINB-2
Specificity GRIN2B antibody was raised against the middle region of GRIN2B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GRIN2B antibody was raised using the middle region of GRIN2B corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR
Assay Information GRIN2B Blocking Peptide, catalog no. 33R-8201, is also available for use as a blocking control in assays to test for specificity of this GRIN2B antibody

Images

Immunofluorescent staining using GRIN2B antibody (70R-5195)

Sample Type : Rat Hippocampal Neurons - 14DIV Primary Antibody Dilution : 1:200 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1:500 Color/Signal Descriptions : Green: GFP Red: NR2b Yellow: VGLUT12

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 163 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIN2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using GRIN2B antibody (70R-5195) | Sample Type : Rat Hippocampal Neurons - 14DIV Primary Antibody Dilution : 1:200 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1:500 Color/Signal Descriptions : Green: GFP Red: NR2b Yellow: VGLUT12
  • Western blot analysis using GRIN2B antibody (70R-5195) | Recommended GRIN2B Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors