Growth Hormone 2 antibody (70R-1713)

Rabbit polyclonal Growth Hormone 2 antibody raised against the middle region of GH2

Synonyms Polyclonal Growth Hormone 2 antibody, Anti-Growth Hormone 2 antibody, hGH-V antibody, GHL antibody, GH2 antibody, GHV antibody, GH-V antibody
Specificity Growth Hormone 2 antibody was raised against the middle region of GH2
Cross Reactivity Human
Applications WB
Immunogen Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
Assay Information Growth Hormone 2 Blocking Peptide, catalog no. 33R-6848, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody


Western Blot analysis using Growth Hormone 2 antibody (70R-1713)

Growth Hormone 2 antibody (70R-1713) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Growth Hormone 2 antibody (70R-1713) | Growth Hormone 2 antibody (70R-1713) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors